PKC alpha Rabbit pAb, Unconjugated

Catalog Number: ABB-A0267
Article Name: PKC alpha Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0267
Supplier Catalog Number: A0267
Alternative Catalog Number: ABB-A0267-100UL,ABB-A0267-20UL,ABB-A0267-1000UL,ABB-A0267-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AAG6, PKCA, PRKACA, PKCI+/-, PKCalpha, PKC-alpha, PKC alpha
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 5578
UniProt: P17252
Purity: Affinity purification
Sequence: MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Target: PRKCA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Protein phosphorylation,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,Serine threonine kinases,mTOR Signaling Pathway,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Cell Adhesion,Cytoskeleton,Microtubules,Actins,TGF-b-Smad Signaling Pathway,Endocrine Metabolism,Immunology Inflammation,B Cell Receptor Signaling Pathway,Neuroscience,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Neurodegenerative Diseases Markers,Cardiovascular,Heart,Hypertrophy