SIRT2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: SIRT2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0273
• Supplier Catalog Number: A0273
• Alternative Catalog Number: ABB-A0273-20UL,ABB-A0273-100UL,ABB-A0273-1000UL,ABB-A0273-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SIR2, SIR2L, SIR2L2, SIRT2

Product Description

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 43kDa
• NCBI: 22933
• UniProt: Q8IXJ6
• Purity: Affinity purification
• Sequence: IMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHA
• Target: SIRT2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis.

Images

Immunohistochemistry analysis of paraffin-embedded Rat ovary using SIRT2 Rabbit pAb (A0273) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using SIRT2 Rabbit pAb (A0273) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western blot analysis of various lysates, using SIRT2 Rabbit pAb (A0273) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using SIRT2 Rabbit pAb (A0273) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunofluorescence analysis of NIH/3T3 cells using SIRT2 Rabbit pAb (A0273) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.