MMP9 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0289
Article Name: MMP9 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0289
Supplier Catalog Number: A0289
Alternative Catalog Number: ABB-A0289-20UL,ABB-A0289-100UL,ABB-A0289-1000UL,ABB-A0289-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GELB, CLG4B, MMP-9, MANDP2, MMP9
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
Clonality: Polyclonal
Molecular Weight: 78kDa
NCBI: 4318
UniProt: P14780
Purity: Affinity purification
Sequence: KYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Target: MMP9
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Extracellular Matrix,Ubiquitin,Cardiovascular,Angiogenesis