CDKN1B/p27KIP1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0290
Article Name: CDKN1B/p27KIP1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0290
Supplier Catalog Number: A0290
Alternative Catalog Number: ABB-A0290-100UL,ABB-A0290-20UL,ABB-A0290-500UL,ABB-A0290-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KIP1, MEN4, CDKN4, MEN1B, P27KIP1, CDKN1B/p27KIP1
This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4).
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 1027
UniProt: P46527
Purity: Affinity purification
Sequence: MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Target: CDKN1B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:20 - 1:50|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cancer,Signal Transduction,Kinase,Serine threonine kinases,PI3K-Akt Signaling Pathway,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors,Cell Cycle Control-G1 S Checkpoint,Immunology Inflammation