TP73 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0385
Article Name: TP73 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0385
Supplier Catalog Number: A0385
Alternative Catalog Number: ABB-A0385-100UL,ABB-A0385-20UL,ABB-A0385-500UL,ABB-A0385-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: P73, CILD47, TP73
This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain multiple tumor suppressor genes. The demonstration that this gene is monoallelically expressed (likely from the maternal allele), supports the notion that it is a candidate gene for neuroblastoma. Many transcript variants resulting from alternative splicing and/or use of alternate promoters have been found for this gene, but the biological validity and the full-length nature of some variants have not been determined.
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 7161
UniProt: O15350
Purity: Affinity purification
Sequence: YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
Target: TP73
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Tumor suppressors,p53 pathway,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis