FGFR3 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0404
Article Name: FGFR3 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0404
Supplier Catalog Number: A0404
Alternative Catalog Number: ABB-A0404-100UL,ABB-A0404-20UL,ABB-A0404-1000UL,ABB-A0404-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ACH, CEK2, JTK4, CD333, HSFGFR3EX, FGFR3
This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia.
Clonality: Polyclonal
Molecular Weight: 88kDa
NCBI: 2261
UniProt: P22607
Purity: Affinity purification
Sequence: VEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT
Target: FGFR3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Growth factors,ESC Pluripotency and Differentiation,Immunology Inflammation,CDs,Stem Cells,Neural Stem Cells,Cardiovascular,Angiogenesis