MAP2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: MAP2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0453
• Supplier Catalog Number: A0453
• Alternative Catalog Number: ABB-A0453-100UL,ABB-A0453-20UL,ABB-A0453-500UL,ABB-A0453-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MAP-2, MAP2A, MAP2B, MAP2C, MAP2

Product Description

This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 200kDa
• NCBI: 4133
• UniProt: P11137
• Purity: Affinity purification
• Sequence: MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKD
• Target: MAP2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Microtubules,Neuroscience, Cell Type Marker,Stem Cells,Neuron marker

Images