Alkaline Phosphatase (ALPL) Rabbit mAb, Unconjugated

Catalog Number: ABB-A0514
Article Name: Alkaline Phosphatase (ALPL) Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0514
Supplier Catalog Number: A0514
Alternative Catalog Number: ABB-A0514-100UL,ABB-A0514-20UL,ABB-A0514-1000UL,ABB-A0514-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HOPS, HPPA, HPPC, HPPI, HPPO, TNAP, TNALP, APTNAP, TNSALP, AP-TNAP, TNS-ALP, Alkaline Phosphatase (ALPL)
This gene encodes a member of the alkaline phosphatase family of proteins. There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2, while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme that is not expressed in any particular tissue and is, therefore, referred to as the tissue-nonspecific form of the enzyme. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme may play a role in bone mineralization. Mutations in this gene have been linked to hypophosphatasia, a disorder that is characterized by hypercalcemia and skeletal defects.
Clonality: Monoclonal
Clone Designation: [ARC0245]
Molecular Weight: 57kDa
NCBI: 249
UniProt: P05186
Purity: Affinity purification
Sequence: MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKT
Target: ALPL
Antibody Type: Primary Antibody
Application Dilute: WB,1:5000 - 1:30000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Kinase,Cell Biology Developmental Biology,Cell Cycle,Stem Cells