HDAC5 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0632
Article Name: HDAC5 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0632
Supplier Catalog Number: A0632
Alternative Catalog Number: ABB-A0632-100UL,ABB-A0632-20UL,ABB-A0632-500UL,ABB-A0632-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HD5, NY-CO-9, HDAC5
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the class II histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. It coimmunoprecipitates only with HDAC3 family member and might form multicomplex proteins. It also interacts with myocyte enhancer factor-2 (MEF2) proteins, resulting in repression of MEF2-dependent genes. This gene is thought to be associated with colon cancer. Two transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 122kDa
NCBI: 10014
UniProt: Q9UQL6
Purity: Affinity purification
Sequence: PLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGELPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
Target: HDAC5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Protein phosphorylation,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G1 S Checkpoint,Wnt -Catenin Signaling Pathway,Immunology Inflammation,NF-kB Signaling Pathway,Stem Cells,Cardiovascular,Heart,Hypertrophy