CD8A Rabbit mAb, Unconjugated

Catalog Number: ABB-A0663
Article Name: CD8A Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0663
Supplier Catalog Number: A0663
Alternative Catalog Number: ABB-A0663-20UL,ABB-A0663-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CD8, p32, Leu2, CD8alpha, CD8A
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.
Clonality: Monoclonal
Clone Designation: [ARC0329]
Molecular Weight: 26kDa
NCBI: 925
UniProt: P01732
Purity: Affinity purification
Sequence: KPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Target: CD8A
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,CDs,Stem Cells