CD34 Rabbit pAb, Unconjugated

Product Overview

• Article Name: CD34 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0761
• Supplier Catalog Number: A0761
• Alternative Catalog Number: ABB-A0761-100UL,ABB-A0761-20UL,ABB-A0761-500UL,ABB-A0761-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CD34, CD34 molecule, GIG3, MORT1

Product Description

The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 41kDa
• NCBI: 947
• UniProt: P28906
• Purity: Affinity purification
• Sequence: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSY
• Target: CD34
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat, ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Immunology Inflammation,CDs,Neuroscience, Cell Type Marker,Stem Cells,Hematopoietic Progenitors,Mesenchymal Stem Cells,Cardiovascular,Heart,Cardiogenesis,Neuron marker.

Images

Western blot analysis of lysates from TF-1 cells usingCD34 Rabbit pAb (A0761) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:30s.

Immunohistochemistry analysis of paraffin-embedded Human placenta using CD34 Rabbit pAb (A0761) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Western blot analysis of lysates from Rat heart, using CD34 Rabbit pAb (A0761) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Immunohistochemistry analysis of paraffin-embeddedHuman spleen tissue usingCD34 Rabbit pAb(A0761) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedHuman pancreas tissue usingCD34 Rabbit pAb(A0761) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedHuman liver cancer tissue usingCD34 Rabbit pAb(A0761) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedHuman kidney tissue usingCD34 Rabbit pAb(A0761) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunofluorescence analysis of paraffin-embedded human placenta using CD34 Rabbit pAb (A0761) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis ofparaffin-embedded Human placenta tissue usingCD34 Rabbit pAb(A0761) atadilution of1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.