Fibrillarin/U3 RNP Rabbit mAb, Unconjugated

Catalog Number: ABB-A0850
Article Name: Fibrillarin/U3 RNP Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0850
Supplier Catalog Number: A0850
Alternative Catalog Number: ABB-A0850-100UL,ABB-A0850-20UL,ABB-A0850-500UL,ABB-A0850-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IP, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FIB, FLRN, Nop1, RNU3IP1, Fibrillarin/U3 RNP
This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.
Clonality: Monoclonal
Clone Designation: [ARC0506]
Molecular Weight: 34kDa
NCBI: 2091
UniProt: P22087
Purity: Affinity purification
Sequence: KYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN
Target: FBL
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:10000|IF/ICC,1:100 - 1:1000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding