[KO Validated] BRG1/SMARCA4 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0887
Article Name: [KO Validated] BRG1/SMARCA4 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0887
Supplier Catalog Number: A0887
Alternative Catalog Number: ABB-A0887-20UL,ABB-A0887-100UL,ABB-A0887-1000UL,ABB-A0887-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BRG1, CSS4, SNF2, SWI2, MRD16, RTPS2, BAF190, SNF2L4, SNF2LB, hSNF2b, BAF190A, SNF2-beta, A4
The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Mutations in this gene cause rhabdoid tumor predisposition syndrome type 2. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 185kDa
NCBI: 6597
UniProt: P51532
Purity: Affinity purification
Sequence: PSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHA
Target: SMARCA4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:20 - 1:50|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling,Cancer,Tumor suppressors,Neuroscience, Cell Type Marker,Stem Cells