ILK Rabbit pAb, Unconjugated

Catalog Number: ABB-A0901
Article Name: ILK Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0901
Supplier Catalog Number: A0901
Alternative Catalog Number: ABB-A0901-100UL,ABB-A0901-20UL,ABB-A0901-1000UL,ABB-A0901-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: P59, ILK-1, ILK-2, p59ILK, HEL-S-28, ILK
This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of this protein is important in the epithelial to mesenchymal transition, and over-expression of this gene is implicated in tumor growth and metastasis. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 3611
UniProt: Q13418
Purity: Affinity purification
Sequence: MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLG
Target: ILK
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Serine threonine kinases,Tyrosine kinases,PI3K-Akt Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Centrosome