NR2F2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: NR2F2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10251
• Supplier Catalog Number: A10251
• Alternative Catalog Number: ABB-A10251-20UL,ABB-A10251-100UL,ABB-A10251-500UL,ABB-A10251-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ARP1, ARP-1, CHTD4, NF-E3, SRXX5, SVP40, COUPTF2, COUPTFB, TFCOUP2, COUPTFII, NR2F2

Product Description

This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 46kDa
• NCBI: 7026
• UniProt: P24468
• Purity: Affinity purification
• Sequence: MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCK
• Target: NR2F2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Growth factors,Endocrine Metabolism,Lipid Metabolism,Neuroscience,Cardiovascular,Angiogenesis

Images