eIF3B Rabbit pAb, Unconjugated

Product Overview

• Article Name: eIF3B Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10259
• Supplier Catalog Number: A10259
• Alternative Catalog Number: ABB-A10259-20UL,ABB-A10259-100UL,ABB-A10259-500UL,ABB-A10259-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PRT1, EIF3S9, EIF3-ETA, EIF3-P110, EIF3-P116, eIF3B

Product Description

Enables RNA binding activity. Contributes to translation initiation factor activity. Involved in several processes, including IRES-dependent viral translational initiation, translational initiation, and viral translational termination-reinitiation. Located in extracellular exosome. Part of eukaryotic translation initiation factor 3 complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 93kDa
• NCBI: 8662
• UniProt: P55884
• Purity: Affinity purification
• Sequence: PVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA
• Target: EIF3B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling

Images