THUMPD3 Rabbit pAb, Unconjugated

Product Overview

• Article Name: THUMPD3 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10407
• Supplier Catalog Number: A10407
• Alternative Catalog Number: ABB-A10407-20UL,ABB-A10407-100UL,ABB-A10407-500UL,ABB-A10407-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: THUMPD3

Product Description

Predicted to enable tRNA (guanine) methyltransferase activity. Predicted to be involved in tRNA methylation. Located in cytosol and nucleolus.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 57kDa
• NCBI: 25917
• UniProt: Q9BV44
• Purity: Affinity purification
• Sequence: MCDIEEATNQLLDVNLHENQKSVQVTESDLGSESELLVTIGATVPTGFEQTAADEVREKLGSSCKISRDRGKIYFVISVESLAQVHCLRSVDNLFVVVQEFQDYQFKQTKEEVLKDFEDLAGKLPWSNPLKVWKINASFKKKKAKRKKINQNSSKEKINNGQEVKIDQRNVKKEFTSHALDSHILDYYENPAIKEDVSTLIGDDLASCKDETDESSKEETEPQVLKFRVTCNRAGEKHCFTSNEAARDFG
• Target: THUMPD3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology

Images