PHGDH Rabbit pAb, Unconjugated

Product Overview

• Article Name: PHGDH Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10461
• Supplier Catalog Number: A10461
• Alternative Catalog Number: ABB-A10461-100UL,ABB-A10461-20UL,ABB-A10461-500UL,ABB-A10461-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IP, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NLS, PDG, PGD, NLS1, PGAD, PGDH, SERA, 3PGDH, 3-PGDH, PHGDHD, HEL-S-113, PHGDH

Product Description

This gene encodes the enzyme which is involved in the early steps of L-serine synthesis in animal cells. L-serine is required for D-serine and other amino acid synthesis. The enzyme requires NAD/NADH as a cofactor and forms homotetramers for activity. Mutations in this gene have been found in a family with congenital microcephaly, psychomotor retardation and other symptoms. Multiple alternatively spliced transcript variants have been found, however the full-length nature of most are not known.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 57kDa
• NCBI: 26227
• UniProt: O43175
• Purity: Affinity purification
• Sequence: EEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSL
• Target: PHGDH
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:100 - 1:500|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Endocrine Metabolism,Amino acid metabolism,Neuroscience.

Images

Western blot analysis of various lysates using PHGDH Rabbit pAb (A10461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:5s.

Immunofluorescence analysis of L929 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:100. Blue: DAPI for nuclear staining.

Western blot analysis of various lysates using PHGDH Rabbit pAb (A10461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunofluorescence analysis of H9C2 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using PHGDH Rabbit pAb (A10461) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 300 µg extracts of HeLa cells using 3 µg PHGDH antibody (A10461). Western blot was performed from the immunoprecipitate using PHGDH antibody (A10461) at a dilution of 1:1000.