TRMT61A Rabbit pAb, Unconjugated

Product Overview

• Article Name: TRMT61A Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10597
• Supplier Catalog Number: A10597
• Alternative Catalog Number: ABB-A10597-100UL,ABB-A10597-20UL,ABB-A10597-1000UL,ABB-A10597-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GCD14, TRM61, Gcd14p, hTRM61, C14orf172, TRMT61A

Product Description

Enables mRNA (adenine-N1-)-methyltransferase activity. Involved in mRNA methylation. Predicted to be located in nucleoplasm. Predicted to be part of tRNA (m1A) methyltransferase complex. Predicted to be active in nucleus.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 31kDa
• NCBI: 115708
• UniProt: Q96FX7
• Purity: Affinity purification
• Sequence: MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTD
• Target: TRMT61A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling

Images