RNASE13 Rabbit pAb, Unconjugated

Product Overview

• Article Name: RNASE13 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1073
• Supplier Catalog Number: A1073
• Alternative Catalog Number: ABB-A1073-20UL,ABB-A1073-100UL,ABB-A1073-1000UL,ABB-A1073-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RAL1, HEL-S-86p, RNASE13

Product Description

Predicted to enable nucleic acid binding activity. Predicted to be located in extracellular region.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 18kDa
• NCBI: 440163
• UniProt: Q5GAN3
• Purity: Affinity purification
• Sequence: MAPAVTRLLFLQLVLGPTLVMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMRGKMQNSDCPKIHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSHQQPPTSCYYNSTLTNQKLYLLCSRKYEADPIGIAGLYSGI
• Target: RNASE13
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling

Images