NTF4 Rabbit pAb, Unconjugated

Catalog Number: ABB-A1081
Article Name: NTF4 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1081
Supplier Catalog Number: A1081
Alternative Catalog Number: ABB-A1081-100UL,ABB-A1081-20UL,ABB-A1081-500UL,ABB-A1081-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NT4, NT5, NT-4, NT-5, NTF5, GLC10, GLC1O, NT-4/5, NTF4
This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neurotrophins including nerve growth factor, brain-derived neurotrophic factor, and neurotrophin 3 prove lethal during early postnatal development, NTF5-deficient mice only show minor cellular deficits and develop normally to adulthood.
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 4909
UniProt: P34130
Purity: Affinity purification
Sequence: QPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRESAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Target: NTF4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors,Neuroscience