SDHB Rabbit pAb, Unconjugated

Catalog Number: ABB-A10821
Article Name: SDHB Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10821
Supplier Catalog Number: A10821
Alternative Catalog Number: ABB-A10821-100UL,ABB-A10821-20UL,ABB-A10821-1000UL,ABB-A10821-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IP, SDH, CWS2, PGL4, SDH1, SDH2, SDHIP, MC2DN4, SDHB
This tumor suppressor gene encodes the iron-sulfur protein subunit of the succinate dehydrogenase (SDH) enzyme complex which plays a critical role in mitochondria. The SDH enzyme complex is composed of four nuclear-encoded subunits. This enzyme complex converts succinate to fumarate which releases electrons as part of the citric acid cycle, and the enzyme complex additionally provides an attachment site for released electrons to be transferred to the oxidative phosphorylation pathway. The SDH enzyme complex plays a role in oxygen-related gene regulation through its conversion of succinate, which is an oxygen sensor that stabilizes the hypoxia-inducible factor 1 (HIF1) transcription factor. Sporadic and familial mutations in this gene result in paragangliomas, pheochromocytoma, and gastrointestinal stromal tumors, supporting a link between mitochondrial dysfunction and tumorigenesis. Mutations in this gene are also implicated in nuclear type 4 mitochondrial complex II deficiency.
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 6390
UniProt: P21912
Purity: Affinity purification
Sequence: AQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
Target: SDHB
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases