Lysozyme (LYZ) Rabbit mAb, Unconjugated

Catalog Number: ABB-A10972
Article Name: Lysozyme (LYZ) Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A10972
Supplier Catalog Number: A10972
Alternative Catalog Number: ABB-A10972-100UL,ABB-A10972-20UL,ABB-A10972-1000UL,ABB-A10972-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LZM, LYZF1, Lysozyme (LYZ)
This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk,and is also present in spleen,lung,kidney,white blood cells,plasma,saliva,and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.
Clonality: Monoclonal
Clone Designation: [ARC57153]
Molecular Weight: 17kDa
NCBI: 4069
UniProt: P61626
Purity: Affinity purification
Sequence: MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
Target: LYZ
Antibody Type: Primary Antibody
Application Dilute: WB,1:30000 - 1:120000|IHC-P,1:1000 - 1:10000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular,Blood