EpCAM Rabbit mAb, Unconjugated

Catalog Number: ABB-A1107
Article Name: EpCAM Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A1107
Supplier Catalog Number: A1107
Alternative Catalog Number: ABB-A1107-100UL,ABB-A1107-20UL,ABB-A1107-1000UL,ABB-A1107-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ESA, KSA, M4S1, MK-1, DIAR5, EGP-2, EGP40, KS1/4, MIC18, TROP1, BerEp4, EGP314, HNPCC8, LYNCH8, MOC-31, Ber-Ep4, TACSTD1, EpCAM
This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
Clonality: Monoclonal
Clone Designation: [ARC0521]
Molecular Weight: 35kDa
NCBI: 4072
UniProt: P16422
Purity: Affinity purification
Sequence: MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCD
Target: EPCAM
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:100 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,CDs