IRF3 Rabbit pAb, Unconjugated

Catalog Number: ABB-A11118
Article Name: IRF3 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11118
Supplier Catalog Number: A11118
Alternative Catalog Number: ABB-A11118-100UL,ABB-A11118-20UL,ABB-A11118-500UL,ABB-A11118-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ChIP, ELISA, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IIAE7, IRF3
This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes. The protein plays an important role in the innate immune response against DNA and RNA viruses. Mutations in this gene are associated with Encephalopathy, acute, infection-induced, herpes-specific, 7.
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 3661
UniProt: Q14653
Purity: Affinity purification
Sequence: PHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGE
Target: IRF3
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.|ChIP,
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Immunology Inflammation,Cytokines,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling