HDAC6 Rabbit pAb, Unconjugated

Catalog Number: ABB-A11259
Article Name: HDAC6 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11259
Supplier Catalog Number: A11259
Alternative Catalog Number: ABB-A11259-100UL,ABB-A11259-20UL,ABB-A11259-500UL,ABB-A11259-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HD6, JM21, CPBHM, PPP1R90, HDAC6
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription.
Clonality: Polyclonal
Molecular Weight: 131kDa
NCBI: 10013
UniProt: Q9UBN7
Purity: Affinity purification
Sequence: VMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSM
Target: HDAC6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Cell Cycle,Cell Cycle Control-G1 S Checkpoint,Wnt -Catenin Signaling Pathway,Immunology Inflammation,NF-kB Signaling Pathway,Stem Cells