IDH2 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11270
Article Name: IDH2 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11270
Supplier Catalog Number: A11270
Alternative Catalog Number: ABB-A11270-100UL,ABB-A11270-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IDH, IDP, IDHM, IDPM, ICD-M, IDH-2, D2HGA2, mNADP-IDH, IDH2
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants.
Clonality: Monoclonal
Clone Designation: [ARC0567]
Molecular Weight: 51kDa
NCBI: 3418
UniProt: P48735
Purity: Affinity purification
Sequence: RHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ
Target: IDH2
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers