PD-L1/CD274 Rabbit pAb, Unconjugated

Catalog Number: ABB-A11273
Article Name: PD-L1/CD274 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11273
Supplier Catalog Number: A11273
Alternative Catalog Number: ABB-A11273-20UL,ABB-A11273-100UL,ABB-A11273-1000UL,ABB-A11273-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: B7-H, B7H1, PDL1, PD-L1, hPD-L1, PDCD1L1, PDCD1LG1, PD-L1/CD274
This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 29126
UniProt: Q9NZQ7
Purity: Affinity purification
Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Target: CD274
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,CDs