LC3B Rabbit pAb, Unconjugated

Catalog Number: ABB-A11282
Article Name: LC3B Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11282
Supplier Catalog Number: A11282
Alternative Catalog Number: ABB-A11282-20UL,ABB-A11282-100UL,ABB-A11282-1000UL,ABB-A11282-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LC3B, ATG8F, MAP1LC3B-a, MAP1A/1BLC3
The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 81631
UniProt: Q9GZQ8
Purity: Affinity purification
Sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYE
Target: MAP1LC3B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Cytoskeleton,Microtubules,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience,Cardiovascular,Heart