ANGPT2 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11306
Article Name: ANGPT2 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11306
Supplier Catalog Number: A11306
Alternative Catalog Number: ABB-A11306-20UL,ABB-A11306-100UL,ABB-A11306-500UL,ABB-A11306-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ANG2, AGPT2, LMPHM10, ANGPT2
This gene belongs to the angiopoietin family of growth factors. The protein encoded by this gene is an antagonist of angiopoietin 1, and both angiopoietin 1 and angiopoietin 2 are ligands for the endothelial TEK receptor tyrosine kinase. Angiopoietin 2 is upregulated in multiple inflammatory diseases and is implicated in the direct control of inflammation-related signaling pathways. The encoded protein affects angiogenesis during embryogenesis and tumorigenesis, disrupts the vascular remodeling ability of angiopoietin 1, and may induce endothelial cell apoptosis. This gene serves a prognostic biomarker for acute respiratory distress syndrome.
Clonality: Monoclonal
Clone Designation: [ARC0571]
Molecular Weight: 57kDa
NCBI: 285
UniProt: O15123
Purity: Affinity purification
Sequence: LTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYR
Target: ANGPT2
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors,Cardiovascular,Angiogenesis