RAC2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: RAC2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1139
• Supplier Catalog Number: A1139
• Alternative Catalog Number: ABB-A1139-20UL,ABB-A1139-100UL,ABB-A1139-500UL,ABB-A1139-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Gx, EN-7, IMD73A, IMD73B, IMD73C, HSPC022, p21-Rac2, RAC2

Product Description

This gene encodes a member of the Ras superfamily of small guanosine triphosphate (GTP)-metabolizing proteins. The encoded protein localizes to the plasma membrane, where it regulates diverse processes, such as secretion, phagocytosis, and cell polarization. Activity of this protein is also involved in the generation of reactive oxygen species. Mutations in this gene are associated with neutrophil immunodeficiency syndrome. There is a pseudogene for this gene on chromosome 6.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 21kDa
• NCBI: 5880
• UniProt: P15153
• Purity: Affinity purification
• Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
• Target: RAC2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Cytoskeleton,Actins,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway

Images