GM130 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11408
Article Name: GM130 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11408
Supplier Catalog Number: A11408
Alternative Catalog Number: ABB-A11408-100UL,ABB-A11408-20UL,ABB-A11408-500UL,ABB-A11408-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GM130, DEDHMB
The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.
Clonality: Monoclonal
Clone Designation: [ARC0589]
Molecular Weight: 113kDa
NCBI: 2801
UniProt: Q08379
Purity: Affinity purification
Sequence: MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSM
Target: GOLGA2
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|IF/ICC,1:100 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction