MMP3 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11418
Article Name: MMP3 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11418
Supplier Catalog Number: A11418
Alternative Catalog Number: ABB-A11418-20UL,ABB-A11418-100UL,ABB-A11418-500UL,ABB-A11418-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SL-1, STMY, STR1, CHDS6, MMP-3, STMY1, MMP3
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
Clonality: Monoclonal
Clone Designation: [ARC51098]
Molecular Weight: 54 kDa
NCBI: 4314
UniProt: P08254
Purity: Affinity purification
Sequence: VRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Target: MMP3
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:200 - 1:800|IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Ubiquitin,Cardiovascular,Angiogenesis