CTGF Rabbit pAb, Unconjugated

Catalog Number: ABB-A11456
Article Name: CTGF Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11456
Supplier Catalog Number: A11456
Alternative Catalog Number: ABB-A11456-100UL,ABB-A11456-20UL,ABB-A11456-1000UL,ABB-A11456-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CTGF, NOV2, HCS24, IGFBP8
The protein encoded by this gene is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis.
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 1490
UniProt: P29279
Purity: Affinity purification
Sequence: GAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCL
Target: CCN2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Cardiovascular,Angiogenesis