SOX2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A11501
Article Name: SOX2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11501
Supplier Catalog Number: A11501
Alternative Catalog Number: ABB-A11501-100UL,ABB-A11501-20UL,ABB-A11501-1000UL,ABB-A11501-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ANOP3, MCOPS3, SOX2
This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT).
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 6657
UniProt: P48431
Purity: Affinity purification
Sequence: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA
Target: SOX2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Cell Biology Developmental Biology,ESC Pluripotency and Differentiation,Neuroscience, Cell Type Marker,Stem Cells,Embryonic Stem Cells,Germline Stem Cells