CHD4 Rabbit pAb, Unconjugated

Catalog Number: ABB-A11574
Article Name: CHD4 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11574
Supplier Catalog Number: A11574
Alternative Catalog Number: ABB-A11574-20UL,ABB-A11574-100UL,ABB-A11574-1000UL,ABB-A11574-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CHD-4, Mi-2b, SIHIWES, Mi2-BETA, CHD4
The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. Somatic mutations in this gene are associated with serous endometrial tumors. Alternative splicing results in multiple transcript variants encoding different isoforms.
Clonality: Polyclonal
Molecular Weight: 218kDa
NCBI: 1108
UniProt: Q14839
Purity: Affinity purification
Sequence: ELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKK
Target: CHD4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling,Immunology Inflammation.