[KD Validated] EGFR Rabbit pAb, Unconjugated

Catalog Number: ABB-A11577
Article Name: [KD Validated] EGFR Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11577
Supplier Catalog Number: A11577
Alternative Catalog Number: ABB-A11577-100UL,ABB-A11577-20UL,ABB-A11577-500UL,ABB-A11577-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ERBB, ERRP, HER1, mENA, ERBB1, PIG61, NISBD2, FR
The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2).
Clonality: Polyclonal
Molecular Weight: 134kDa
NCBI: 1956
UniProt: P00533
Purity: Affinity purification
Sequence: QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
Target: EGFR
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,G protein signaling,Kinase,Tyrosine kinases,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway,Cardiovascular,Angiogenesis