CBS Rabbit mAb, Unconjugated

Catalog Number: ABB-A11612
Article Name: CBS Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11612
Supplier Catalog Number: A11612
Alternative Catalog Number: ABB-A11612-20UL,ABB-A11612-100UL,ABB-A11612-1000UL,ABB-A11612-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CBSL, HIP4, CBS
The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. This gene is a major contributor to cellular hydrogen sulfide production. Multiple alternatively spliced transcript variants have been found for this gene.
Clonality: Monoclonal
Clone Designation: [ARC0643]
Molecular Weight: 61kDa
NCBI: 875
UniProt: P35520
Purity: Affinity purification
Sequence: EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Target: CBS
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:4000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism.