PAK4 Rabbit pAb, Unconjugated

Catalog Number: ABB-A11646
Article Name: PAK4 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11646
Supplier Catalog Number: A11646
Alternative Catalog Number: ABB-A11646-100UL,ABB-A11646-20UL,ABB-A11646-1000UL,ABB-A11646-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PAK4
PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 10298
UniProt: O96013
Purity: Affinity purification
Sequence: HDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLD
Target: PAK4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Signal Transduction,Kinase,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cytoskeleton,Microfilaments,TGF-b-Smad Signaling Pathway.