CD13/ANPEP Rabbit mAb, Unconjugated

Catalog Number: ABB-A11669
Article Name: CD13/ANPEP Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11669
Supplier Catalog Number: A11669
Alternative Catalog Number: ABB-A11669-100UL,ABB-A11669-20UL,ABB-A11669-500UL,ABB-A11669-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: APN, AP-M, AP-N, CD13, LAP1, P150, PEPN, hAPN, GP150, CD13/ANPEP
Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. This membrane-bound zinc metalloprotease is known to serve as a receptor for the HCoV-229E alphacoronavirus as well as other non-human coronaviruses. This gene has also been shown to promote angiogenesis, tumor growth, and metastasis and defects in this gene are associated with various types of leukemia and lymphoma.
Clonality: Monoclonal
Clone Designation: [ARC0670]
Molecular Weight: 110kDa
NCBI: 290
UniProt: P15144
Purity: Affinity purification
Sequence: NAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALA
Target: ANPEP
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IF-P,1:100 - 1:1000|IHC-P,1:2000 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors,Mesenchymal Stem Cells,Cardiovascular,Angiogenesis.