TDP-43/TARDBP Rabbit pAb, Unconjugated

Catalog Number: ABB-A1183
Article Name: TDP-43/TARDBP Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1183
Supplier Catalog Number: A1183
Alternative Catalog Number: ABB-A1183-100UL,ABB-A1183-20UL,ABB-A1183-500UL,ABB-A1183-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ALS10, TDP-43, TDP-43/TARDBP
HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 23435
UniProt: Q13148
Purity: Affinity purification
Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISV
Target: TARDBP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.|RIP,1:20 - 1:50
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Apoptosis,Neuroscience,Neurodegenerative Diseases,Neurodegenerative Diseases Markers,Other Neurological disorders.