S6 Ribosomal Protein (RPS6) Rabbit mAb, Unconjugated

Catalog Number: ABB-A11874
Article Name: S6 Ribosomal Protein (RPS6) Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11874
Supplier Catalog Number: A11874
Alternative Catalog Number: ABB-A11874-100UL,ABB-A11874-20UL,ABB-A11874-1000UL,ABB-A11874-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: S6, eS6, S6 Ribosomal Protein (RPS6)
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Clonality: Monoclonal
Clone Designation: [ARC50655]
Molecular Weight: 29kDa
NCBI: 6194
UniProt: P62753
Purity: Affinity purification
Sequence: MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP
Target: RPS6
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IF/ICC,1:100 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Signal Transduction,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway.