KRAS Rabbit pAb, Unconjugated

Product Overview

• Article Name: KRAS Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1190
• Supplier Catalog Number: A1190
• Alternative Catalog Number: ABB-A1190-100UL,ABB-A1190-20UL,ABB-A1190-500UL,ABB-A1190-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NS, NS3, OES, CFC2, RALD, K-Ras, KRAS1, KRAS2, RASK2, KI-RAS, C-K-RAS, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, K-Ras 2, C-K-RAS, c-Ki-ras, c-Ki-ras2, KRAS

Product Description

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 22kDa
• NCBI: 3845
• UniProt: P01116
• Purity: Affinity purification
• Sequence: DEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM
• Target: KRAS
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,G protein signaling,Small G proteins,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Cytoskeleton,Actins,TGF-b-Smad Signaling Pathway,ESC Pluripotency and Differentiation,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Warburg Effect,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,Jak-Stat-IL-6 Receptor Signaling Pathway,NF-kB Signaling Pathway,Cardiovascular,Angiogenesis.

Images