JAK1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11963
Article Name: JAK1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11963
Supplier Catalog Number: A11963
Alternative Catalog Number: ABB-A11963-100UL,ABB-A11963-20UL,ABB-A11963-1000UL,ABB-A11963-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: JTK3, AIIDE, JAK1A, JAK1B, JAK1
This gene encodes a membrane protein that is a member of a class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. The encoded kinase phosphorylates STAT proteins (signal transducers and activators of transcription) and plays a key role in interferon-alpha/beta, interferon-gamma, and cytokine signal transduction. This gene plays a crucial role in effecting the expression of genes that mediate inflammation, epithelial remodeling, and metastatic cancer progression. This gene is a key component of the interleukin-6 (IL-6)/JAK1/STAT3 immune and inflammation response and is a therapeutic target for alleviating cytokine storms. The kinase activity of this gene is directly inhibited by the suppressor of cytokine signalling 1 (SOCS1) protein. Alternative splicing results in multiple transcript variants.
Clonality: Monoclonal
Clone Designation: [ARC0434]
Molecular Weight: 133kDa
NCBI: 3716
UniProt: P23458
Purity: Affinity purification
Sequence: GTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLAS
Target: JAK1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,PI3K-Akt Signaling Pathway,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Immunology Inflammation,Cytokines,Jak-Stat-IL-6 Receptor Signaling Pathway.