PD-1/CD279 Rabbit pAb, Unconjugated

Catalog Number: ABB-A11973
Article Name: PD-1/CD279 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11973
Supplier Catalog Number: A11973
Alternative Catalog Number: ABB-A11973-100UL,ABB-A11973-20UL,ABB-A11973-500UL,ABB-A11973-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PD1, PD-1, CD279, SLEB2, hPD-1, hPD-l, hSLE1, PD-1/CD279
Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells, it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differentiation of CD4+ T cells into T regulatory cells. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, this protein has been shown to be involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity.
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 5133
UniProt: Q15116
Purity: Affinity purification
Sequence: TGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGT
Target: PDCD1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs.