STAT1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A12075
Article Name: STAT1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A12075
Supplier Catalog Number: A12075
Alternative Catalog Number: ABB-A12075-100UL,ABB-A12075-20UL,ABB-A12075-1000UL,ABB-A12075-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CANDF7, IMD31A, IMD31B, IMD31C, ISGF-3, STAT91, STAT1
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. The protein encoded by this gene can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. The protein plays an important role in immune responses to viral, fungal and mycobacterial pathogens. Mutations in this gene are associated with Immunodeficiency 31B, 31A, and 31C.
Clonality: Polyclonal
Molecular Weight: 87kDa
NCBI: 6772
UniProt: P42224
Purity: Affinity purification
Sequence: NYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
Target: STAT1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Signal Transduction,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway.