AIFM2/FSP1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: AIFM2/FSP1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A12128
• Supplier Catalog Number: A12128
• Alternative Catalog Number: ABB-A12128-100UL,ABB-A12128-20UL,ABB-A12128-500UL,ABB-A12128-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: AMID, FSP1, PRG3, AIFM2/FSP1

Product Description

This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 41kDa
• NCBI: 84883
• UniProt: Q9BRQ8
• Purity: Affinity purification
• Sequence: KDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYL
• Target: AIFM2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Apoptosis.

Images