SLC25A24 Rabbit pAb, Unconjugated

Product Overview

• Article Name: SLC25A24 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A12138
• Supplier Catalog Number: A12138
• Alternative Catalog Number: ABB-A12138-20UL,ABB-A12138-100UL,ABB-A12138-1000UL,ABB-A12138-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: APC1, SCAMC1, SCAMC-1, SLC25A24

Product Description

This gene encodes a carrier protein that transports ATP-Mg exchanging it for phosphate. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 53kDa
• NCBI: 29957
• UniProt: Q6NUK1
• Purity: Affinity purification
• Sequence: MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA
• Target: SLC25A24
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat

Images