[KO Validated] SELENBP1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A1222
Article Name: [KO Validated] SELENBP1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1222
Supplier Catalog Number: A1222
Alternative Catalog Number: ABB-A1222-20UL,ABB-A1222-100UL,ABB-A1222-500UL,ABB-A1222-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MTO, LPSB, SP56, hSBP, EHMTO, SBP56, HEL-S-134P, P1
This gene encodes a member of the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. The effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins, and decreased expression of this gene may be associated with several types of cancer. The encoded protein may play a selenium-dependent role in ubiquitination/deubiquitination-mediated protein degradation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 8991
UniProt: Q13228
Purity: Affinity purification
Sequence: SLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKNEGGTWSVEKVIQVPPKKVKGWLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLFLGGSIVKGGPVQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI
Target: SELENBP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Tumor suppressors,Signal Transduction,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases.