MAP1LC3A Rabbit mAb, Unconjugated

Catalog Number: ABB-A12319
Article Name: MAP1LC3A Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A12319
Supplier Catalog Number: A12319
Alternative Catalog Number: ABB-A12319-100UL,ABB-A12319-20UL,ABB-A12319-1000UL,ABB-A12319-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IP, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LC3, LC3A, ATG8E, MAP1ALC3, MAP1BLC3, MAP1LC3A
MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis.
Clonality: Monoclonal
Clone Designation: [ARC2636]
Molecular Weight: 14kDa
NCBI: 84557
UniProt: Q9H492
Purity: Affinity purification
Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE
Target: MAP1LC3A
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Cell Biology Developmental Biology,Autophagy,Cytoskeleton,Microtubules,Endocrine Metabolism,Mitochondrial metabolism,Cardiovascular,Heart.